(data stored in ACNUC7421 zone)

EMBL: CP000031.PE380

CP000031.PE380       Location/Qualifiers
FT   CDS             complement(401873..402334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0389"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93707"
FT                   /db_xref="GOA:Q5LXH4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH4"
FT                   /protein_id="AAV93707.1"
FT                   /translation="MDQIDHRIVRALQRDGRMTISDLADKVGLSPTPCARRLERLQRDG
FT                   VITGYSARVDPAKLGLGVSVFVSVELERQERAAVDAFERAIRTCDEVMECYLMTGSRDI
FT                   LLRVLVADLAAFDAFLENRLMQIPGIRNLRSNFALRTMVQRDSLPAIRR"
     MDQIDHRIVR ALQRDGRMTI SDLADKVGLS PTPCARRLER LQRDGVITGY SARVDPAKLG        60
     LGVSVFVSVE LERQERAAVD AFERAIRTCD EVMECYLMTG SRDILLRVLV ADLAAFDAFL       120
     ENRLMQIPGI RNLRSNFALR TMVQRDSLPA IRR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page