(data stored in ACNUC7421 zone)

EMBL: CP000031.PE381

CP000031.PE381       Location/Qualifiers
FT   CDS             402464..403513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0390"
FT                   /product="glutamate/leucine/phenylalanine/valine
FT                   dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00208;
FT                   match to protein family HMM PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93708"
FT                   /db_xref="GOA:Q5LXH3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH3"
FT                   /protein_id="AAV93708.1"
FT                   /translation="MQITPVAAPEHEQVVRIADPESGLLGFIAIHSTRRGPAAGGVRMR
FT                   PYAQEADALNDALRLSRGMTYKNAAAGLDLGGGKAVIMADPATQKTPDLLAAFGSAVET
FT                   LAGRYWTAEDMGMTPADMARIGTRTTCVAGLADGDFASGDPSPITARGIFYAIRTAAKH
FT                   RLGSVDLTGRTVAVQGLGHVGHYLCGYLHQAGANLIVTDIDRAQVARVAERYGATAVAP
FT                   DAIYGVEADIFAPCAIGAILNAETIPQLKVRVVAGGANNQLATPEDATRLHDLGILYAP
FT                   DYVANGGGIINVATEILKISGREAWVASRLAALDDTMDRILTRARILSVSPAEVADATV
FT                   DEILQAKAA"
     MQITPVAAPE HEQVVRIADP ESGLLGFIAI HSTRRGPAAG GVRMRPYAQE ADALNDALRL        60
     SRGMTYKNAA AGLDLGGGKA VIMADPATQK TPDLLAAFGS AVETLAGRYW TAEDMGMTPA       120
     DMARIGTRTT CVAGLADGDF ASGDPSPITA RGIFYAIRTA AKHRLGSVDL TGRTVAVQGL       180
     GHVGHYLCGY LHQAGANLIV TDIDRAQVAR VAERYGATAV APDAIYGVEA DIFAPCAIGA       240
     ILNAETIPQL KVRVVAGGAN NQLATPEDAT RLHDLGILYA PDYVANGGGI INVATEILKI       300
     SGREAWVASR LAALDDTMDR ILTRARILSV SPAEVADATV DEILQAKAA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page