(data stored in ACNUC7421 zone)

EMBL: CP000031.PE384

CP000031.PE384       Location/Qualifiers
FT   CDS             405115..405927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0393"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93711"
FT                   /db_xref="GOA:Q5LWE9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE9"
FT                   /protein_id="AAV93711.1"
FT                   /translation="MPENTRGVNWVSVMMGNSRLENSVPVAYPWGKGTSTAAKGPPMSS
FT                   DNDTSPVNPLPPVVVALVLFIMGIEITFSLGARGIVGGPQAVGWRLAAMQSYAFSPDIL
FT                   TWMWETGRWPVEHVIRLVSYPFVSVSFTQSLFVCVFVLAMGKMVAESFGSLAMLVVFLV
FT                   SGIGGALGYALLTGSPVALIGGFPPVYGLIGAFTWLLWRKLSLVGQHQARAFSLIAFLM
FT                   GAQLLFGLLFGGGLDWVADLAGFATGFALSFLLSPGGWARMRGRIRHD"
     MPENTRGVNW VSVMMGNSRL ENSVPVAYPW GKGTSTAAKG PPMSSDNDTS PVNPLPPVVV        60
     ALVLFIMGIE ITFSLGARGI VGGPQAVGWR LAAMQSYAFS PDILTWMWET GRWPVEHVIR       120
     LVSYPFVSVS FTQSLFVCVF VLAMGKMVAE SFGSLAMLVV FLVSGIGGAL GYALLTGSPV       180
     ALIGGFPPVY GLIGAFTWLL WRKLSLVGQH QARAFSLIAF LMGAQLLFGL LFGGGLDWVA       240
     DLAGFATGFA LSFLLSPGGW ARMRGRIRHD                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page