(data stored in ACNUC7421 zone)

EMBL: CP000031.PE390

CP000031.PE390       Location/Qualifiers
FT   CDS             412384..413241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0399"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93717"
FT                   /db_xref="GOA:Q5LWE3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE3"
FT                   /protein_id="AAV93717.1"
FT                   /translation="MNYQKLRLPAGLYFVGTPIGSARDITLRALDVLASAEVIAAEDTR
FT                   SLRHLLDIHGVPLDGRRVLAYHDHSGAGAQARLLEALAEGKSVAYASEAGMPLIADPGF
FT                   ELSRAAAEAGHMVTCAPGPSAVLTALTLAGLPTDAFFFAGFLPNAAAARKTRLETLRGV
FT                   PGTLVFYESPKRLAASLRDMAEVLGGERPAALCRELTKKFEETRRDTLAGLAEALAEAP
FT                   VKGEVVLLVDRARSGPVKDSDIEQDLLAALETHSVRDAADLVARMHDVPRRPVYQLALK
FT                   LGKG"
     MNYQKLRLPA GLYFVGTPIG SARDITLRAL DVLASAEVIA AEDTRSLRHL LDIHGVPLDG        60
     RRVLAYHDHS GAGAQARLLE ALAEGKSVAY ASEAGMPLIA DPGFELSRAA AEAGHMVTCA       120
     PGPSAVLTAL TLAGLPTDAF FFAGFLPNAA AARKTRLETL RGVPGTLVFY ESPKRLAASL       180
     RDMAEVLGGE RPAALCRELT KKFEETRRDT LAGLAEALAE APVKGEVVLL VDRARSGPVK       240
     DSDIEQDLLA ALETHSVRDA ADLVARMHDV PRRPVYQLAL KLGKG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page