(data stored in ACNUC7421 zone)

EMBL: CP000031.PE395

CP000031.PE395       Location/Qualifiers
FT   CDS             complement(417186..417764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0404"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93722"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD8"
FT                   /protein_id="AAV93722.1"
FT                   /translation="MTRLHLVRHGPTHAKSMVGWSDLPADLSDTGFLTRLAAHLPPQAL
FT                   VVSSDLRRAADTASAIQGDRTRLPHRAALREIHFGAWELRRFAEIEAEDPEHIRAYWET
FT                   PGDVRPPGGESWNEVCARVDAEIDALIAAHPGADLIVVGHFGMILTQVQRALRLEADQA
FT                   FAHRIDNLSVTEITRLPQGWEVGRINHLV"
     MTRLHLVRHG PTHAKSMVGW SDLPADLSDT GFLTRLAAHL PPQALVVSSD LRRAADTASA        60
     IQGDRTRLPH RAALREIHFG AWELRRFAEI EAEDPEHIRA YWETPGDVRP PGGESWNEVC       120
     ARVDAEIDAL IAAHPGADLI VVGHFGMILT QVQRALRLEA DQAFAHRIDN LSVTEITRLP       180
     QGWEVGRINH LV                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page