(data stored in ACNUC9435 zone)

EMBL: CP000031.PE398

CP000031.PE398       Location/Qualifiers
FT   CDS             419259..420083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E83058"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93725"
FT                   /db_xref="GOA:Q5LWD5"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD5"
FT                   /protein_id="AAV93725.1"
FT                   /translation="MKQFFAAGLALALCLIAPLRAASAGELIPEDILAAMRQADVVILG
FT                   ETHDNPRHHLVQAEAIAALQPGAVVWEMLTEEGAQRLRRKAVNDPAELERILQWAELGW
FT                   PPLAMYLPVFEAADAPVYGALVPRAAARAAMETGAAAAMGADAARFGLTVPLAEADQAA
FT                   READQQAAHCNAMPPEMLPQLVAIQRLRDAVLARAILRAQDETGGPVAVITGNGHARAD
FT                   RGIPVFLSRISPGLRVYVLGQSEGGLIEGRFDAVIDSPAAPREDPCAAFDKS"
     MKQFFAAGLA LALCLIAPLR AASAGELIPE DILAAMRQAD VVILGETHDN PRHHLVQAEA        60
     IAALQPGAVV WEMLTEEGAQ RLRRKAVNDP AELERILQWA ELGWPPLAMY LPVFEAADAP       120
     VYGALVPRAA ARAAMETGAA AAMGADAARF GLTVPLAEAD QAAREADQQA AHCNAMPPEM       180
     LPQLVAIQRL RDAVLARAIL RAQDETGGPV AVITGNGHAR ADRGIPVFLS RISPGLRVYV       240
     LGQSEGGLIE GRFDAVIDSP AAPREDPCAA FDKS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page