(data stored in ACNUC7421 zone)

EMBL: CP000031.PE40

CP000031.PE40        Location/Qualifiers
FT   CDS             41301..41885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E82361"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93372"
FT                   /db_xref="GOA:Q5LWJ8"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ8"
FT                   /protein_id="AAV93372.1"
FT                   /translation="MRWLVALLLVLAAPLAADPVPALFDVTGVAADDVLNVREDPSAGS
FT                   EVIGTLAPDAVGVEVVDLTFGGDWGRVNVNETSGWVSMRYMQQQPESDGVWMTPRFTCS
FT                   GTEPFWSLTVEQGVGARFQIMGEAEQALPAGLLRPGAGLIDRFALPLGHNLAILRQMQC
FT                   HDGMSDRAYGLDVGLMLNGSLYAGCCTLLPN"
     MRWLVALLLV LAAPLAADPV PALFDVTGVA ADDVLNVRED PSAGSEVIGT LAPDAVGVEV        60
     VDLTFGGDWG RVNVNETSGW VSMRYMQQQP ESDGVWMTPR FTCSGTEPFW SLTVEQGVGA       120
     RFQIMGEAEQ ALPAGLLRPG AGLIDRFALP LGHNLAILRQ MQCHDGMSDR AYGLDVGLML       180
     NGSLYAGCCT LLPN                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page