(data stored in ACNUC7421 zone)

EMBL: CP000031.PE401

CP000031.PE401       Location/Qualifiers
FT   CDS             421878..422918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0410"
FT                   /product="molybdopterin biosynthesis protein MoeB,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93728"
FT                   /db_xref="GOA:Q5LWD2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD2"
FT                   /protein_id="AAV93728.1"
FT                   /translation="MLLVLALAAGLWTMGHVMGVSRRARLVMLCALFAVVLMLQFALPV
FT                   SHPLRAATGGSPALWLLIGGFALLAFGYGSGVAWLKARAQGRPAETTAKPGSFTETELD
FT                   RYARHIVLRELGGPGQKRLKQARVLVIGAGGLGAPALQYLAAAGVGTIGVIDDDVVENA
FT                   NLQRQVIHRDADIGKPKVFSAEAAMLAQNPAIAVRPYHRRLTEEIAADLFADYDLILDG
FT                   TDNFTTRYLANQVAVAQGKPLISGALSQWEGQLSVFHPAGDTPCYQCIFPEAPAPGLAP
FT                   SCAEAGVIGPLPGVVGAMMAVEAIKLITDAGAPLKGEMLIYDALYGESRKIRLSRRADC
FT                   PICGQG"
     MLLVLALAAG LWTMGHVMGV SRRARLVMLC ALFAVVLMLQ FALPVSHPLR AATGGSPALW        60
     LLIGGFALLA FGYGSGVAWL KARAQGRPAE TTAKPGSFTE TELDRYARHI VLRELGGPGQ       120
     KRLKQARVLV IGAGGLGAPA LQYLAAAGVG TIGVIDDDVV ENANLQRQVI HRDADIGKPK       180
     VFSAEAAMLA QNPAIAVRPY HRRLTEEIAA DLFADYDLIL DGTDNFTTRY LANQVAVAQG       240
     KPLISGALSQ WEGQLSVFHP AGDTPCYQCI FPEAPAPGLA PSCAEAGVIG PLPGVVGAMM       300
     AVEAIKLITD AGAPLKGEML IYDALYGESR KIRLSRRADC PICGQG                      346
//

If you have problems or comments...

PBIL Back to PBIL home page