(data stored in ACNUC7421 zone)

EMBL: CP000031.PE403

CP000031.PE403       Location/Qualifiers
FT   CDS             complement(423669..424136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93730"
FT                   /db_xref="GOA:Q5LWD0"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD0"
FT                   /protein_id="AAV93730.1"
FT                   /translation="MTGREEMAKTETTKITPASFTEVLKSMQGPVSMTSLVKPQLEQFW
FT                   DAQEKLLAESERFTRHWFERRHEAIRTALDAARSATAADPANPAQAMETVMDWQRHSVE
FT                   RLVEDAREWFDTVSRCADYVSKTEAEAVGETLNEAQDLARKATKSAKSEPV"
     MTGREEMAKT ETTKITPASF TEVLKSMQGP VSMTSLVKPQ LEQFWDAQEK LLAESERFTR        60
     HWFERRHEAI RTALDAARSA TAADPANPAQ AMETVMDWQR HSVERLVEDA REWFDTVSRC       120
     ADYVSKTEAE AVGETLNEAQ DLARKATKSA KSEPV                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page