(data stored in ACNUC9435 zone)

EMBL: CP000031.PE404

CP000031.PE404       Location/Qualifiers
FT   CDS             complement(424229..425440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0413"
FT                   /product="Cys/Met metabolism PLP-dependent enzyme family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93731"
FT                   /db_xref="GOA:Q5LWC9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC9"
FT                   /protein_id="AAV93731.1"
FT                   /translation="MTKTNRPAGPMTTAIHAGEAPDPATLASAPPIHMSSTYVSEDVLG
FT                   FSAHDLTPQSPYAYSRWANPTVAMLEAKIAAMQGTEACLCTASGMAAAAAIFFTFLSAG
FT                   DHVIVSDVSYAGVAELARDTLPRMGIAVSTVDMSDLAAVAAAIRPETRLIHTETPVNPI
FT                   GRLTDLAAISALARQAGALLSCDATFASPLGMDTVALGVDLTMHSVTKYICGHGDAVAG
FT                   AVCGRADLVSRMRVEAAIHHGGVLSPFNAWLIARGAATLPLRMKAHAAGAHAVAEWLEA
FT                   DPRVGRVIYPGLPSHPQAELAARQMSNMSAMISFQVGDAATGERLARQMIERLEVIHYA
FT                   VSLGHHRSLIFWMGTEGLMETSFRLEGAQLEAYRAYAGDGIFRLSVGLEDPEDLIADLD
FT                   RAIA"
     MTKTNRPAGP MTTAIHAGEA PDPATLASAP PIHMSSTYVS EDVLGFSAHD LTPQSPYAYS        60
     RWANPTVAML EAKIAAMQGT EACLCTASGM AAAAAIFFTF LSAGDHVIVS DVSYAGVAEL       120
     ARDTLPRMGI AVSTVDMSDL AAVAAAIRPE TRLIHTETPV NPIGRLTDLA AISALARQAG       180
     ALLSCDATFA SPLGMDTVAL GVDLTMHSVT KYICGHGDAV AGAVCGRADL VSRMRVEAAI       240
     HHGGVLSPFN AWLIARGAAT LPLRMKAHAA GAHAVAEWLE ADPRVGRVIY PGLPSHPQAE       300
     LAARQMSNMS AMISFQVGDA ATGERLARQM IERLEVIHYA VSLGHHRSLI FWMGTEGLME       360
     TSFRLEGAQL EAYRAYAGDG IFRLSVGLED PEDLIADLDR AIA                         403
//

If you have problems or comments...

PBIL Back to PBIL home page