(data stored in ACNUC9435 zone)

EMBL: CP000031.PE405

CP000031.PE405       Location/Qualifiers
FT   CDS             425562..427577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0414"
FT                   /product="peptidyl-dipeptidase, putative"
FT                   /note="identified by similarity to SP:P27236; match to
FT                   protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93732"
FT                   /db_xref="GOA:Q5LWC8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC8"
FT                   /protein_id="AAV93732.1"
FT                   /translation="MTNPILADWQTPFDIAPFDRIADSDFAPALEVALAEHRAEIAAIA
FT                   DSPEAPTFANVIEALEAAGGALDRVLGVFFTVAGADSNPAREELQRAFSPQLAAHFSEI
FT                   SANKALFARVAAVWEARADLELSDEQQRVLMLTHRGFVRAGAALSGEAEARMKEIKARL
FT                   AVLGTEFTQNLLADERDWFMDLSEDDLEGLPDFVTAAARAAGQEKEAAGPVVTLSRSLI
FT                   VPFLQFSPRRDLRERAYRAWVARGANGGKTDNRAIATETLTLRQERAALLGYDSFAAYK
FT                   LETEMARSPDRVRDLLMQVWAPARARAEADAEVLTAMMQEDGINGPLEPWDWHYYAARR
FT                   RKAEHDLDEAALKPYLQLDRMIEASFACANRLFGLEFRPLDIALYHPDCRAWEVTRDGR
FT                   HVAVFIGDYFARGSKRSGAWCSAMRAQAKFPRTQAPVVINVCNFAKGDPALLSYDDART
FT                   LFHEFGHALHQMLSDVTYESVSGTSVARDFVELPSQLYEHWLEVPEVLAEFATHAETGA
FT                   PMPAEMLEKVLGAANFDQGFQTVEYVASALVDLAFHDGPAPSDPMAKQAEVLAELGMPH
FT                   AIGMRHATPHFAHVFAGDGYSSGYYSYMWSEVMDADAFAAFEEAGGAFDPDRAEALERH
FT                   ILSTGGSRDAEDLYLAFRGRLPGVEALLKGRGLIAA"
     MTNPILADWQ TPFDIAPFDR IADSDFAPAL EVALAEHRAE IAAIADSPEA PTFANVIEAL        60
     EAAGGALDRV LGVFFTVAGA DSNPAREELQ RAFSPQLAAH FSEISANKAL FARVAAVWEA       120
     RADLELSDEQ QRVLMLTHRG FVRAGAALSG EAEARMKEIK ARLAVLGTEF TQNLLADERD       180
     WFMDLSEDDL EGLPDFVTAA ARAAGQEKEA AGPVVTLSRS LIVPFLQFSP RRDLRERAYR       240
     AWVARGANGG KTDNRAIATE TLTLRQERAA LLGYDSFAAY KLETEMARSP DRVRDLLMQV       300
     WAPARARAEA DAEVLTAMMQ EDGINGPLEP WDWHYYAARR RKAEHDLDEA ALKPYLQLDR       360
     MIEASFACAN RLFGLEFRPL DIALYHPDCR AWEVTRDGRH VAVFIGDYFA RGSKRSGAWC       420
     SAMRAQAKFP RTQAPVVINV CNFAKGDPAL LSYDDARTLF HEFGHALHQM LSDVTYESVS       480
     GTSVARDFVE LPSQLYEHWL EVPEVLAEFA THAETGAPMP AEMLEKVLGA ANFDQGFQTV       540
     EYVASALVDL AFHDGPAPSD PMAKQAEVLA ELGMPHAIGM RHATPHFAHV FAGDGYSSGY       600
     YSYMWSEVMD ADAFAAFEEA GGAFDPDRAE ALERHILSTG GSRDAEDLYL AFRGRLPGVE       660
     ALLKGRGLIA A                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page