(data stored in ACNUC7421 zone)

EMBL: CP000031.PE409

CP000031.PE409       Location/Qualifiers
FT   CDS             complement(431678..432214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0418"
FT                   /product="membrane protein, putative"
FT                   /note="identified by similarity to GB:CAE53834.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93736"
FT                   /db_xref="GOA:Q5LWC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC4"
FT                   /protein_id="AAV93736.1"
FT                   /translation="MDSLAPSRIWVMRLSYAGLAMVILFFHLLPLDTLPKRWASPDLLL
FT                   ALTLAWSLRRPDFVPPLLIAIVILLADLLLQRPPGLLAALTVAGTVFLHSRFGNHGETG
FT                   FVAEWLAVAVVLMAIALLYRIVLAITSVDQAPLFLVASQLVLTILIYPLVAGASQAVFG
FT                   VRHLTPADAETLGAR"
     MDSLAPSRIW VMRLSYAGLA MVILFFHLLP LDTLPKRWAS PDLLLALTLA WSLRRPDFVP        60
     PLLIAIVILL ADLLLQRPPG LLAALTVAGT VFLHSRFGNH GETGFVAEWL AVAVVLMAIA       120
     LLYRIVLAIT SVDQAPLFLV ASQLVLTILI YPLVAGASQA VFGVRHLTPA DAETLGAR         178
//

If you have problems or comments...

PBIL Back to PBIL home page