(data stored in ACNUC9435 zone)

EMBL: CP000031.PE41

CP000031.PE41        Location/Qualifiers
FT   CDS             complement(41882..42478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0042"
FT                   /product="alkylated DNA repair protein, putative"
FT                   /note="identified by similarity to SP:P05050; match to
FT                   protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93373"
FT                   /db_xref="GOA:Q5LWJ7"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ7"
FT                   /protein_id="AAV93373.1"
FT                   /translation="MLNLRGVEIRKGALDGPAQARLIEALRPVLKAAPLFTPTMPNGKP
FT                   LSVRMTSAGSLGWVTDKGGYRYQPTHPKGMAWPAIPPEVLDLWHGVTGQDRAPDCCLIN
FT                   YYGEGARMGLHQDRDEADLTWPVVSLSLGDDALFRIGNTSRGGKTESVWLNSGDVVVMG
FT                   GPARLIYHGIDRIRFGSSRLLPKGGRLNLTLRVAG"
     MLNLRGVEIR KGALDGPAQA RLIEALRPVL KAAPLFTPTM PNGKPLSVRM TSAGSLGWVT        60
     DKGGYRYQPT HPKGMAWPAI PPEVLDLWHG VTGQDRAPDC CLINYYGEGA RMGLHQDRDE       120
     ADLTWPVVSL SLGDDALFRI GNTSRGGKTE SVWLNSGDVV VMGGPARLIY HGIDRIRFGS       180
     SRLLPKGGRL NLTLRVAG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page