(data stored in ACNUC7421 zone)

EMBL: CP000031.PE414

CP000031.PE414       Location/Qualifiers
FT   CDS             complement(437092..437673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0423"
FT                   /product="DNA-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93741"
FT                   /db_xref="GOA:Q5LWB9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB9"
FT                   /protein_id="AAV93741.1"
FT                   /translation="MSETAPRQTTPIIGTRMRELRKARGLTLKQLAAATGLSIGYLSQL
FT                   ERQAADPSVRALNVISTALGVGINWFFPDPDTVSDPEADLVVRADRRRTLRFSSGVRDE
FT                   LISPNLSGQLELIVTTFDPGAGSGAELYAHRGEEAGFIVEGQLEVTVGARLVTLGVGDT
FT                   VQFASTIPHRYHNPGPGRTVMIWAVTPPYY"
     MSETAPRQTT PIIGTRMREL RKARGLTLKQ LAAATGLSIG YLSQLERQAA DPSVRALNVI        60
     STALGVGINW FFPDPDTVSD PEADLVVRAD RRRTLRFSSG VRDELISPNL SGQLELIVTT       120
     FDPGAGSGAE LYAHRGEEAG FIVEGQLEVT VGARLVTLGV GDTVQFASTI PHRYHNPGPG       180
     RTVMIWAVTP PYY                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page