(data stored in ACNUC7421 zone)

EMBL: CP000031.PE415

CP000031.PE415       Location/Qualifiers
FT   CDS             437751..438938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0424"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93742"
FT                   /db_xref="GOA:Q5LWB8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB8"
FT                   /protein_id="AAV93742.1"
FT                   /translation="MRNSSFLRAYGFWHWGEGLQTVLFTWYMAFHVGLPASQIGFYQAL
FT                   VLSPFLLFTIAGGILTDRIGARRSFRAATVLFGLLLIGYGVLDHVFGFVPVLFFAYCLA
FT                   AGVVSAVSNPAIDTFIPDATPRRAQENALLAANAHNMAKLAGNLTGLTLPLLHAVGGFG
FT                   VNGLLMLASAASLRPVQPATRQGAPEPELSERPSLRRLWAHFRECPENFDILLSSAMLG
FT                   LLVVPVGYILLPLALRANFPGYGDLLAVMTVSSWLGAIAATWAIGRLSRRIGHPGRIAL
FT                   LVWGGYACALVTLPLVPGFAWLCVLVAVLGMVKLGKAMVYGKYIRNCPDTLRGSVIAVE
FT                   QTAFWGLATLGTFLLGWLVDLIGLVPTIHLVALSVGLAALALALRGRLSGLTPAL"
     MRNSSFLRAY GFWHWGEGLQ TVLFTWYMAF HVGLPASQIG FYQALVLSPF LLFTIAGGIL        60
     TDRIGARRSF RAATVLFGLL LIGYGVLDHV FGFVPVLFFA YCLAAGVVSA VSNPAIDTFI       120
     PDATPRRAQE NALLAANAHN MAKLAGNLTG LTLPLLHAVG GFGVNGLLML ASAASLRPVQ       180
     PATRQGAPEP ELSERPSLRR LWAHFRECPE NFDILLSSAM LGLLVVPVGY ILLPLALRAN       240
     FPGYGDLLAV MTVSSWLGAI AATWAIGRLS RRIGHPGRIA LLVWGGYACA LVTLPLVPGF       300
     AWLCVLVAVL GMVKLGKAMV YGKYIRNCPD TLRGSVIAVE QTAFWGLATL GTFLLGWLVD       360
     LIGLVPTIHL VALSVGLAAL ALALRGRLSG LTPAL                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page