(data stored in ACNUC7421 zone)

EMBL: CP000031.PE423

CP000031.PE423       Location/Qualifiers
FT   CDS             447721..448167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0432"
FT                   /product="rrf2 family protein"
FT                   /note="identified by match to protein family HMM PF02082;
FT                   match to protein family HMM TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93750"
FT                   /db_xref="GOA:Q5LWB0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB0"
FT                   /protein_id="AAV93750.1"
FT                   /translation="MRITKRTNIAVRLLMFCAAHPGRLVTKSEIAEVCNVSENHLAQVI
FT                   NQLSQLGFLTTQRGRNGGMCLGMAADAIRIGEVFRHVEGNLPMVECFADADNSCPLTDA
FT                   CRLRLALRDAAQAFYASLDEITLDALVCDNTDLLKILNPVVCAR"
     MRITKRTNIA VRLLMFCAAH PGRLVTKSEI AEVCNVSENH LAQVINQLSQ LGFLTTQRGR        60
     NGGMCLGMAA DAIRIGEVFR HVEGNLPMVE CFADADNSCP LTDACRLRLA LRDAAQAFYA       120
     SLDEITLDAL VCDNTDLLKI LNPVVCAR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page