(data stored in ACNUC9435 zone)

EMBL: CP000031.PE424

CP000031.PE424       Location/Qualifiers
FT   CDS             complement(448191..450707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0433"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93751"
FT                   /db_xref="GOA:Q5LWA9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA9"
FT                   /protein_id="AAV93751.1"
FT                   /translation="MSLRLAARLARRELRGGLRGFRIFLACLALGVAAIAAVGSVRSAI
FT                   EAGLSREGAALLGGDAQMGFTYRFATPEERDWMQARASRVSELVDFRSMAVVGAERALT
FT                   QVKAVDGAYPLLGSVTLDPDLPLDQALAGAKGLPGGVMEPVLSDRLGLQPGDRFRLGTQ
FT                   EFVLMARLMQVPDGVADGFALGPRTLVRTADLAQSGLLAPGTLFDTKYRLDLPPDSDLA
FT                   SIAQDARGRFTDSGLRWTDARNGAPGIADFTRRLGAFLILVGLSGLAVGGIGVSAAVRA
FT                   YLADKTTTIATLRTLGADRRIVFQTYFLQIGALSGLGILLGLVLGGLAPLLLAPLIEAQ
FT                   LPVPAVFAIYPEPLAEAAIYGLLTALVFTLWPLARTEEVRAATLLRDALSRAPLLPRLR
FT                   YVLATGAGLALLCGLAAWFSGALALTLWTLGGIAGALLLLAIAASAVQALSRAAAPLAR
FT                   GRPALRWALASISSPRQGAAPVMLSLGLGLSVLAAVGQIDGTLRNAISGNLPDVAPSYF
FT                   FVDIQRDQMPGFTARLESDPGVSRVESAPMLRGIITRINDRPAREVAGNHWVVRGDRGV
FT                   TYSAELPDTTRLTEGAWWPQDYDGPPLISFAAEEGAEMGLQLGDTLTVNILGRDITARI
FT                   ASFREVDFSTAGMGFVMAMNPAALSGAPHSNIATVYAEPDAEAAILRDLASAYPNITAI
FT                   RVRDAIDRAAGLLAGLASATSYGAGVSLLTGFLVLIGAAAAGQGARIYEAAVLRTLGAS
FT                   RRRILLSLALRSALLGAAAGTIALAAGILGGWAVSRFVFETSFTVIWPSAILIVLGGVL
FT                   AVLGASLVFALPPLAARPARVLRARE"
     MSLRLAARLA RRELRGGLRG FRIFLACLAL GVAAIAAVGS VRSAIEAGLS REGAALLGGD        60
     AQMGFTYRFA TPEERDWMQA RASRVSELVD FRSMAVVGAE RALTQVKAVD GAYPLLGSVT       120
     LDPDLPLDQA LAGAKGLPGG VMEPVLSDRL GLQPGDRFRL GTQEFVLMAR LMQVPDGVAD       180
     GFALGPRTLV RTADLAQSGL LAPGTLFDTK YRLDLPPDSD LASIAQDARG RFTDSGLRWT       240
     DARNGAPGIA DFTRRLGAFL ILVGLSGLAV GGIGVSAAVR AYLADKTTTI ATLRTLGADR       300
     RIVFQTYFLQ IGALSGLGIL LGLVLGGLAP LLLAPLIEAQ LPVPAVFAIY PEPLAEAAIY       360
     GLLTALVFTL WPLARTEEVR AATLLRDALS RAPLLPRLRY VLATGAGLAL LCGLAAWFSG       420
     ALALTLWTLG GIAGALLLLA IAASAVQALS RAAAPLARGR PALRWALASI SSPRQGAAPV       480
     MLSLGLGLSV LAAVGQIDGT LRNAISGNLP DVAPSYFFVD IQRDQMPGFT ARLESDPGVS       540
     RVESAPMLRG IITRINDRPA REVAGNHWVV RGDRGVTYSA ELPDTTRLTE GAWWPQDYDG       600
     PPLISFAAEE GAEMGLQLGD TLTVNILGRD ITARIASFRE VDFSTAGMGF VMAMNPAALS       660
     GAPHSNIATV YAEPDAEAAI LRDLASAYPN ITAIRVRDAI DRAAGLLAGL ASATSYGAGV       720
     SLLTGFLVLI GAAAAGQGAR IYEAAVLRTL GASRRRILLS LALRSALLGA AAGTIALAAG       780
     ILGGWAVSRF VFETSFTVIW PSAILIVLGG VLAVLGASLV FALPPLAARP ARVLRARE         838
//

If you have problems or comments...

PBIL Back to PBIL home page