(data stored in ACNUC7421 zone)

EMBL: CP000031.PE429

CP000031.PE429       Location/Qualifiers
FT   CDS             complement(453151..453708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0438"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein/Tat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93756"
FT                   /db_xref="GOA:Q5LWA4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA4"
FT                   /protein_id="AAV93756.1"
FT                   /translation="MITRRTFIAASAAAGTLPWAIQAKASDAFDPTPQVVRIKKQFEPG
FT                   RLLILPRSFYLYYVTEEREAIRYGCGVGKAGLEFTGTATIDVKKEWPTWRPTPEMIERD
FT                   PRTYAKFVDNNYIQPGGPENPLGARALYLFQNGVDTYFRIHGTTQPQTIGHAASNGCIR
FT                   MLNEHVIDLYNRVPLGTVVTVL"
     MITRRTFIAA SAAAGTLPWA IQAKASDAFD PTPQVVRIKK QFEPGRLLIL PRSFYLYYVT        60
     EEREAIRYGC GVGKAGLEFT GTATIDVKKE WPTWRPTPEM IERDPRTYAK FVDNNYIQPG       120
     GPENPLGARA LYLFQNGVDT YFRIHGTTQP QTIGHAASNG CIRMLNEHVI DLYNRVPLGT       180
     VVTVL                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page