(data stored in ACNUC9435 zone)

EMBL: CP000031.PE432

CP000031.PE432       Location/Qualifiers
FT   CDS             454811..455152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93759"
FT                   /db_xref="GOA:Q5LWA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWA1"
FT                   /protein_id="AAV93759.1"
FT                   /translation="MEIIMQILVGIAGLSLAVLIYAWAYGRAHDPAAPAWARGQLFASV
FT                   ASLVATSLAPIGAGYLTAGLLWPDGLSLVWGLPVAIGAVPVVWVFSLRLLRRGRDRAQS
FT                   PTGLARAMA"
     MEIIMQILVG IAGLSLAVLI YAWAYGRAHD PAAPAWARGQ LFASVASLVA TSLAPIGAGY        60
     LTAGLLWPDG LSLVWGLPVA IGAVPVVWVF SLRLLRRGRD RAQSPTGLAR AMA              113
//

If you have problems or comments...

PBIL Back to PBIL home page