(data stored in ACNUC9435 zone)

EMBL: CP000031.PE436

CP000031.PE436       Location/Qualifiers
FT   CDS             456283..456858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAQ60337.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93763"
FT                   /db_xref="GOA:Q5LW97"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW97"
FT                   /protein_id="AAV93763.1"
FT                   /translation="MSIYVRPRVPGATIFFTVTLANKGSGLLTDQIGLLRTTVWQTRRE
FT                   RPFHIDAWVVLPDHLHAVWTLPRGDTDFSTRWGAIKARFTMGVRKAGFSPPPDLPVVRS
FT                   GRYAGLKPGLRSEKREAGVWQRRFWEHHIRGPDEYLAAVSFCHNDPVKHGLVTDAKAWP
FT                   FSTVHRKMQTSGEMCRAGFSPPSVVGPG"
     MSIYVRPRVP GATIFFTVTL ANKGSGLLTD QIGLLRTTVW QTRRERPFHI DAWVVLPDHL        60
     HAVWTLPRGD TDFSTRWGAI KARFTMGVRK AGFSPPPDLP VVRSGRYAGL KPGLRSEKRE       120
     AGVWQRRFWE HHIRGPDEYL AAVSFCHNDP VKHGLVTDAK AWPFSTVHRK MQTSGEMCRA       180
     GFSPPSVVGP G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page