(data stored in ACNUC7421 zone)

EMBL: CP000031.PE437

CP000031.PE437       Location/Qualifiers
FT   CDS             complement(456890..458545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:P37797"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93764"
FT                   /db_xref="GOA:Q5LW96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW96"
FT                   /protein_id="AAV93764.2"
FT                   /translation="MAAYQYVYHMQGVSKSYPGGKKCFENIHLSFLPGVKIGVVGVNGA
FT                   GKSTLMKIMAGLDKDFTGEAWAAEGAKVGYLPQEPHLDPNLTVRENVMLGVKAKKDILD
FT                   RYNELAMNYSDETADEMASLQDQIDAENLWDLDSQIDVSMEALRCPPDDANVESLSGGE
FT                   RRRVALCKLLLEAPDMLLLDEPTNHLDAETIAWLQQHLIDYKGTILIVTHDRYFLDSIT
FT                   GWILELDRGRGIPYEGNYSAWLEQKAKRLEQEAREDKAKQKTLERELEWMRQGQKARQA
FT                   KSKARIQAYNEMANQSEREKVGRAQIVIPNGPRLGSKVIEVEGLSKHMGDKQLIEGLDF
FT                   SLPPGGIVGVIGPNGAGKSTLFKMITGQEQPDAGSIEIGDTVKLSYVDQSRDDLKDGDT
FT                   VWEAITGGAEIIQLGDAQVNSRAYCSSFNFKGGDQQKKVSLLSGGERNRVHMARLLKEG
FT                   GNVLLLDEPTNDLDVETLRALEDALVDFAGCAVVISHDRFFLDRICTHILAFEGDAHVE
FT                   WFEGNFEDYEEDKKRRLGPDALEPKRLKHKKFVR"
     MAAYQYVYHM QGVSKSYPGG KKCFENIHLS FLPGVKIGVV GVNGAGKSTL MKIMAGLDKD        60
     FTGEAWAAEG AKVGYLPQEP HLDPNLTVRE NVMLGVKAKK DILDRYNELA MNYSDETADE       120
     MASLQDQIDA ENLWDLDSQI DVSMEALRCP PDDANVESLS GGERRRVALC KLLLEAPDML       180
     LLDEPTNHLD AETIAWLQQH LIDYKGTILI VTHDRYFLDS ITGWILELDR GRGIPYEGNY       240
     SAWLEQKAKR LEQEAREDKA KQKTLERELE WMRQGQKARQ AKSKARIQAY NEMANQSERE       300
     KVGRAQIVIP NGPRLGSKVI EVEGLSKHMG DKQLIEGLDF SLPPGGIVGV IGPNGAGKST       360
     LFKMITGQEQ PDAGSIEIGD TVKLSYVDQS RDDLKDGDTV WEAITGGAEI IQLGDAQVNS       420
     RAYCSSFNFK GGDQQKKVSL LSGGERNRVH MARLLKEGGN VLLLDEPTND LDVETLRALE       480
     DALVDFAGCA VVISHDRFFL DRICTHILAF EGDAHVEWFE GNFEDYEEDK KRRLGPDALE       540
     PKRLKHKKFV R                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page