(data stored in ACNUC7421 zone)

EMBL: CP000031.PE448

CP000031.PE448       Location/Qualifiers
FT   CDS             467598..467999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0457"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC47480.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93775"
FT                   /db_xref="GOA:Q5LW85"
FT                   /db_xref="InterPro:IPR032347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW85"
FT                   /protein_id="AAV93775.1"
FT                   /translation="MRQLLFILACCVGLVGPAQAQSDEIKAVIGNQIEAFLADDFATAF
FT                   TFASPMIREIFRTPENFGSMVRNGYPMVWRPAEIRYLGLEEREGTLWQLVRVTDRQGLA
FT                   HVLAYQMVNLESGWKINAVQVLETPPPSV"
     MRQLLFILAC CVGLVGPAQA QSDEIKAVIG NQIEAFLADD FATAFTFASP MIREIFRTPE        60
     NFGSMVRNGY PMVWRPAEIR YLGLEEREGT LWQLVRVTDR QGLAHVLAYQ MVNLESGWKI       120
     NAVQVLETPP PSV                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page