(data stored in ACNUC7421 zone)

EMBL: CP000031.PE449

CP000031.PE449       Location/Qualifiers
FT   CDS             complement(467966..470359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93777"
FT                   /db_xref="GOA:Q5LW84"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW84"
FT                   /protein_id="AAV93777.1"
FT                   /translation="MILIGPLLHLGIRRQIGNRTPRFPQRPLWHHSIDSARLGPERQGC
FT                   IGIDQPVVRCAGLVHLQPQGVGAARADPMIGVPLIDQIPGPIEIQPRETGVDPLGPVDV
FT                   SIDRAELVAGDCHAIDEMANPMRLDHDIAEPGRHLARQKDIVGDAQRAERESAIEVRVR
FT                   VLFVSPFQAAIVDIVLGKSRARVSPDQYDTRCARPVVNGIALKEVVAQDHMVLPRHDGK
FT                   MTEPGRPAMAQLDVVGIGVEPDAAAVRHVQRLFRREKLAPVDQHALTATTDRGDSTILW
FT                   PTDKTIVKRECSAVRSQPDRAAMGVTLELDVLHVELRQRAEAAEIQHVFEAAEGEDLGA
FT                   CRIIERRVQCDLTGPHVFRAHIDFAPDTRSRHQGTHRNIGDIRHVVQLTRVIGVICRLR
FT                   DKGIGIPSGTRHRHQLPVADHPSGRETGPVWNSRLHVDRRGDRHIAPAHVQRFVIRPVQ
FT                   QRLKRLAKGGFLVTKGRDIGRKIKILGQQQHLVDRHRHRALEIDLRCQADRLPQEISSA
FT                   RHENAAPSGCAIGGLECGRVVGDPIAHRTVITDIDLAQHVTQERAGDIGDLDIVDPHDA
FT                   AIRPFEIEAEMTIERRRPPDHVDTAAIAGSHDARHLDHIAIAGQRGRGPLFRHAADMRT
FT                   ACRTGPPGDPNAGQVATDRLDPDLDLQVTARLQGRLPHIAQLLNRCGLLQFQAAAKIGI
FT                   RRNKGRIRRPIIGIRPRRAVAARPHIQPQLKGGRHEVDAVGDCLVHTNPFPNRATDDLP
FT                   ARFHVTGPGRTRTRQMGRTKGLIPAHSTVTVTLPQTEGGGVSRT"
     MILIGPLLHL GIRRQIGNRT PRFPQRPLWH HSIDSARLGP ERQGCIGIDQ PVVRCAGLVH        60
     LQPQGVGAAR ADPMIGVPLI DQIPGPIEIQ PRETGVDPLG PVDVSIDRAE LVAGDCHAID       120
     EMANPMRLDH DIAEPGRHLA RQKDIVGDAQ RAERESAIEV RVRVLFVSPF QAAIVDIVLG       180
     KSRARVSPDQ YDTRCARPVV NGIALKEVVA QDHMVLPRHD GKMTEPGRPA MAQLDVVGIG       240
     VEPDAAAVRH VQRLFRREKL APVDQHALTA TTDRGDSTIL WPTDKTIVKR ECSAVRSQPD       300
     RAAMGVTLEL DVLHVELRQR AEAAEIQHVF EAAEGEDLGA CRIIERRVQC DLTGPHVFRA       360
     HIDFAPDTRS RHQGTHRNIG DIRHVVQLTR VIGVICRLRD KGIGIPSGTR HRHQLPVADH       420
     PSGRETGPVW NSRLHVDRRG DRHIAPAHVQ RFVIRPVQQR LKRLAKGGFL VTKGRDIGRK       480
     IKILGQQQHL VDRHRHRALE IDLRCQADRL PQEISSARHE NAAPSGCAIG GLECGRVVGD       540
     PIAHRTVITD IDLAQHVTQE RAGDIGDLDI VDPHDAAIRP FEIEAEMTIE RRRPPDHVDT       600
     AAIAGSHDAR HLDHIAIAGQ RGRGPLFRHA ADMRTACRTG PPGDPNAGQV ATDRLDPDLD       660
     LQVTARLQGR LPHIAQLLNR CGLLQFQAAA KIGIRRNKGR IRRPIIGIRP RRAVAARPHI       720
     QPQLKGGRHE VDAVGDCLVH TNPFPNRATD DLPARFHVTG PGRTRTRQMG RTKGLIPAHS       780
     TVTVTLPQTE GGGVSRT                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page