(data stored in ACNUC9435 zone)

EMBL: CP000031.PE45

CP000031.PE45        Location/Qualifiers
FT   CDS             46922..47899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0046"
FT                   /product="thiamine biosynthesis oxidoreductase ThiO,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93377"
FT                   /db_xref="GOA:Q5LWJ3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ3"
FT                   /protein_id="AAV93377.1"
FT                   /translation="MTLWSVIGAGVAGLTVATEMVARGARVQVFDPGGPPGPHGCSWWA
FT                   GGMLAPWCEYENAEEPVLRLGQQAIGWWEQHTTVTRRGTLVVANPRDLPDLRRFGRRTE
FT                   GFREINQTEILGLESDLGAFSKGLHFPDEAHLDPRRALSDLYRGLLDKDVDFHRKPAPA
FT                   GLENAIDCRGLHAREVLHDLRGVKGEMLVIRAPDVALTRPVRLLHPRMPLYVVPRADHV
FT                   YMLGATMIESEDSGRITARSMLELLSAAYALNPAFGEAEVLEIGVDLRPAFPDNLPRIR
FT                   RLGRTIYANGLYRHGYLLAPALAQGVADLALNNTHTELVDEDRA"
     MTLWSVIGAG VAGLTVATEM VARGARVQVF DPGGPPGPHG CSWWAGGMLA PWCEYENAEE        60
     PVLRLGQQAI GWWEQHTTVT RRGTLVVANP RDLPDLRRFG RRTEGFREIN QTEILGLESD       120
     LGAFSKGLHF PDEAHLDPRR ALSDLYRGLL DKDVDFHRKP APAGLENAID CRGLHAREVL       180
     HDLRGVKGEM LVIRAPDVAL TRPVRLLHPR MPLYVVPRAD HVYMLGATMI ESEDSGRITA       240
     RSMLELLSAA YALNPAFGEA EVLEIGVDLR PAFPDNLPRI RRLGRTIYAN GLYRHGYLLA       300
     PALAQGVADL ALNNTHTELV DEDRA                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page