(data stored in ACNUC7421 zone)

EMBL: CP000031.PE451

CP000031.PE451       Location/Qualifiers
FT   CDS             complement(470475..471332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93778"
FT                   /db_xref="GOA:Q5LW82"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW82"
FT                   /protein_id="AAV93778.1"
FT                   /translation="MVLPDPPFCCATVMTCPMRRLSHAASQHSARPPVHNGKTTATLRH
FT                   NRTNQSLTKLREACDGGCGMGRLLIALWICMTAACPAAAGAWLREKGHGFTSASVTLYR
FT                   FQGAYDYKTTAYAEWGMAERLTLGIDINEQPGLAGHALIFARYPLWDLGTKGRFAAELG
FT                   LGAHHWLGDWAPMGKLTLSYGKGLETRWGNGWLAVDTGWERRSGTKTNIFKLDMTAGLS
FT                   TARRIDPMLQVETAYVPGHPLFWTITPSLLIEGSKGRTWVLGLERKSDLPGSLNIKFSL
FT                   WREF"
     MVLPDPPFCC ATVMTCPMRR LSHAASQHSA RPPVHNGKTT ATLRHNRTNQ SLTKLREACD        60
     GGCGMGRLLI ALWICMTAAC PAAAGAWLRE KGHGFTSASV TLYRFQGAYD YKTTAYAEWG       120
     MAERLTLGID INEQPGLAGH ALIFARYPLW DLGTKGRFAA ELGLGAHHWL GDWAPMGKLT       180
     LSYGKGLETR WGNGWLAVDT GWERRSGTKT NIFKLDMTAG LSTARRIDPM LQVETAYVPG       240
     HPLFWTITPS LLIEGSKGRT WVLGLERKSD LPGSLNIKFS LWREF                       285
//

If you have problems or comments...

PBIL Back to PBIL home page