(data stored in ACNUC7421 zone)

EMBL: CP000031.PE452

CP000031.PE452       Location/Qualifiers
FT   CDS             471280..471909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0461"
FT                   /product="ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93779"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW81"
FT                   /protein_id="AAV93779.1"
FT                   /translation="MGHVITVAQQKGGSGKTTLAVNLAVAFMRAGRRVALMDTDPQGSA
FT                   GRWFMARLEAGGDPGLEFSTASAWGVSYEVRKLAKDHDIVIIDTPPKADSDLRPALREA
FT                   DLVLIPVATSHLDLWAVEMVLYLAEREDKPALMVMTRNRPGTRLAQDVAAKAQELNAEL
FT                   AQAALANRVTYAETLGHGRAALEAPKGPAHAEVTGLMREIEIALGL"
     MGHVITVAQQ KGGSGKTTLA VNLAVAFMRA GRRVALMDTD PQGSAGRWFM ARLEAGGDPG        60
     LEFSTASAWG VSYEVRKLAK DHDIVIIDTP PKADSDLRPA LREADLVLIP VATSHLDLWA       120
     VEMVLYLAER EDKPALMVMT RNRPGTRLAQ DVAAKAQELN AELAQAALAN RVTYAETLGH       180
     GRAALEAPKG PAHAEVTGLM REIEIALGL                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page