(data stored in ACNUC7421 zone)

EMBL: CP000031.PE453

CP000031.PE453       Location/Qualifiers
FT   CDS             471959..472285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0462"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93780"
FT                   /db_xref="GOA:Q5LW80"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW80"
FT                   /protein_id="AAV93780.1"
FT                   /translation="MPKIAKAAPVQTVITTFEMTPGTCQDLLEALTEAYADFISKQPGF
FT                   VAAGLHVNDAQTRIANYSQWQRREDFLAMLRTPEMRERNRRINEMCKSFEPVMYEVAET
FT                   FDGN"
     MPKIAKAAPV QTVITTFEMT PGTCQDLLEA LTEAYADFIS KQPGFVAAGL HVNDAQTRIA        60
     NYSQWQRRED FLAMLRTPEM RERNRRINEM CKSFEPVMYE VAETFDGN                    108
//

If you have problems or comments...

PBIL Back to PBIL home page