(data stored in ACNUC7421 zone)

EMBL: CP000031.PE455

CP000031.PE455       Location/Qualifiers
FT   CDS             472839..473417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93782"
FT                   /db_xref="GOA:Q5LW78"
FT                   /db_xref="InterPro:IPR021869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW78"
FT                   /protein_id="AAV93782.1"
FT                   /translation="MVVSLVLLAGSLLLLGWSLLTFGSILTPALLVAALGVVVGVVLVL
FT                   RFRLRAAPVWIVIDGSNVLYWRDETPNLHTVRQCVEGLVRNGWTPLLWFDANVGYLVGS
FT                   QYMGPHELSRALRYPASHINVAPKGTPADPLLIEQAGDLGARIVTNDRFRDWVETYPQV
FT                   ADAGLFLRGSASDQGVSLRFAEEPARKRA"
     MVVSLVLLAG SLLLLGWSLL TFGSILTPAL LVAALGVVVG VVLVLRFRLR AAPVWIVIDG        60
     SNVLYWRDET PNLHTVRQCV EGLVRNGWTP LLWFDANVGY LVGSQYMGPH ELSRALRYPA       120
     SHINVAPKGT PADPLLIEQA GDLGARIVTN DRFRDWVETY PQVADAGLFL RGSASDQGVS       180
     LRFAEEPARK RA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page