(data stored in ACNUC7421 zone)

EMBL: CP000031.PE466

CP000031.PE466       Location/Qualifiers
FT   CDS             complement(480732..481415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAN29788.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93793"
FT                   /db_xref="GOA:Q5LW67"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW67"
FT                   /protein_id="AAV93793.1"
FT                   /translation="MTFLRYAIYFLPPASEAWAGFGASWLGWDVETGQELAHPAETGLD
FT                   VAALTATPRKYGLHATMKPPFRLAEGQDVDALRRACATLAASRPAVTLDGLEIARLGRF
FT                   LALRPVGELGALNALAAACVTELDPFRAPATPQELVRRRAARLSPEQDAHLLSWGYPYV
FT                   LDQFRFHITLTGRLDDDMLMQAQTLLQRRLGPLLPVPFTLADLALVGEAGDGRFHLIHR
FT                   YALSR"
     MTFLRYAIYF LPPASEAWAG FGASWLGWDV ETGQELAHPA ETGLDVAALT ATPRKYGLHA        60
     TMKPPFRLAE GQDVDALRRA CATLAASRPA VTLDGLEIAR LGRFLALRPV GELGALNALA       120
     AACVTELDPF RAPATPQELV RRRAARLSPE QDAHLLSWGY PYVLDQFRFH ITLTGRLDDD       180
     MLMQAQTLLQ RRLGPLLPVP FTLADLALVG EAGDGRFHLI HRYALSR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page