(data stored in ACNUC9435 zone)

EMBL: CP000031.PE472

CP000031.PE472       Location/Qualifiers
FT   CDS             complement(485983..486294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0482"
FT                   /product="NADH-ubiquinone oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93799"
FT                   /db_xref="GOA:Q5LW61"
FT                   /db_xref="InterPro:IPR006885"
FT                   /db_xref="InterPro:IPR038532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW61"
FT                   /protein_id="AAV93799.1"
FT                   /translation="MRARIYQPARNAMTSGMAKTRKWVLEYAPGSAREVDPLMGWTSSS
FT                   DTQSQVRLRFDSKEEALDYARAHGIDAVVTEPHKRKPNLRARGYGENFATDRRGPWTH"
     MRARIYQPAR NAMTSGMAKT RKWVLEYAPG SAREVDPLMG WTSSSDTQSQ VRLRFDSKEE        60
     ALDYARAHGI DAVVTEPHKR KPNLRARGYG ENFATDRRGP WTH                         103
//

If you have problems or comments...

PBIL Back to PBIL home page