(data stored in ACNUC9435 zone)

EMBL: CP000031.PE473

CP000031.PE473       Location/Qualifiers
FT   CDS             complement(486480..487127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0483"
FT                   /product="microcystin dependent protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93800"
FT                   /db_xref="GOA:Q5LW60"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW60"
FT                   /protein_id="AAV93800.1"
FT                   /translation="MSKNAFTTFATAAALSLSLIAPASQARAGTDPFVGELMLAGFNFC
FT                   PRGWAEANGALLAISSNTTLFSLLGTMYGGDGRTTFALPDLRGRVAIGVGTGPGLQPIT
FT                   QGERLGQPTTTQTIATMAPHTHLATSNASTSIHVSSDDANIQDPGNAFLGTTSTPTYTT
FT                   TQPDEALANGSATTGVTTTILSTGQGLPQENHQPSLGLKYCIALFGVYPSRN"
     MSKNAFTTFA TAAALSLSLI APASQARAGT DPFVGELMLA GFNFCPRGWA EANGALLAIS        60
     SNTTLFSLLG TMYGGDGRTT FALPDLRGRV AIGVGTGPGL QPITQGERLG QPTTTQTIAT       120
     MAPHTHLATS NASTSIHVSS DDANIQDPGN AFLGTTSTPT YTTTQPDEAL ANGSATTGVT       180
     TTILSTGQGL PQENHQPSLG LKYCIALFGV YPSRN                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page