(data stored in ACNUC7421 zone)

EMBL: CP000031.PE481

CP000031.PE481       Location/Qualifiers
FT   CDS             494499..495119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0491"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE79871.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93808"
FT                   /db_xref="GOA:Q5LW52"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW52"
FT                   /protein_id="AAV93808.2"
FT                   /translation="MSQIESLFVTRLYRARLSEHGPAIDPEEMEASCYSIAEDDEAGQE
FT                   WCEENGYPGYTSYASLTDLPWRFPIFADLVTSLDAHVAAFAADLEFDLDGRKLVLEDLW
FT                   INILPQGGMHSSHLHPHSVISGTTYVAMPEGASALKLEDPRSGRMMAAPTRTKTARREL
FT                   QPFIYMKPDVGDVLLWESWLRHEVPMNMSEEERISVSFNYRWD"
     MSQIESLFVT RLYRARLSEH GPAIDPEEME ASCYSIAEDD EAGQEWCEEN GYPGYTSYAS        60
     LTDLPWRFPI FADLVTSLDA HVAAFAADLE FDLDGRKLVL EDLWINILPQ GGMHSSHLHP       120
     HSVISGTTYV AMPEGASALK LEDPRSGRMM AAPTRTKTAR RELQPFIYMK PDVGDVLLWE       180
     SWLRHEVPMN MSEEERISVS FNYRWD                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page