(data stored in ACNUC9435 zone)

EMBL: CP000031.PE482

CP000031.PE482       Location/Qualifiers
FT   CDS             495167..495532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0491a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG018;
FT                   similar gene identified in less than 5 other Roseobacter
FT                   strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0491a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86008"
FT                   /db_xref="GOA:V5UYV7"
FT                   /db_xref="UniProtKB/TrEMBL:V5UYV7"
FT                   /protein_id="AHB86008.1"
FT                   /translation="MYDHTAILLSEAEQVVFTTHARIAPTLTELVIIVVFAPIALVIWL
FT                   FIHRSFRSTVYMITTKRVLVIEKQGIVDQIPIQDIQRVTGRRRSMMIYGSDTRLWLARL
FT                   QDGWQFETILERVRKLI"
     MYDHTAILLS EAEQVVFTTH ARIAPTLTEL VIIVVFAPIA LVIWLFIHRS FRSTVYMITT        60
     KRVLVIEKQG IVDQIPIQDI QRVTGRRRSM MIYGSDTRLW LARLQDGWQF ETILERVRKL       120
     I                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page