(data stored in ACNUC9435 zone)

EMBL: CP000031.PE483

CP000031.PE483       Location/Qualifiers
FT   CDS             495649..496491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0492"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by similarity to GB:BAC74954.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93809"
FT                   /db_xref="GOA:Q5LW51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW51"
FT                   /protein_id="AAV93809.1"
FT                   /translation="MVDVPRRVTAARIRSLSPGCASPLPETCRRAIAGGGRPVCPPGPE
FT                   HAGMELDFIIEGWAGHLSYLLLVLSMLMRHMLWLRLFVIASAMAGIAFDHFWLQNPVGV
FT                   FWQSLLVLVNVAELALLWRNDRRARFTVEEDRFRETLLSGLSPGRCRRLLDLGRWETLS
FT                   TGTVLTREGQRPEFLTYMASGAVRIERQGRLLRLVGEGHFIGEMSMMGDGLAVATAVMQ
FT                   DSGRVWRIERVKLDRLRESSPAAMAAIETGVARDMRAKLAYQNTGPDTAAQPADGPAD"
     MVDVPRRVTA ARIRSLSPGC ASPLPETCRR AIAGGGRPVC PPGPEHAGME LDFIIEGWAG        60
     HLSYLLLVLS MLMRHMLWLR LFVIASAMAG IAFDHFWLQN PVGVFWQSLL VLVNVAELAL       120
     LWRNDRRARF TVEEDRFRET LLSGLSPGRC RRLLDLGRWE TLSTGTVLTR EGQRPEFLTY       180
     MASGAVRIER QGRLLRLVGE GHFIGEMSMM GDGLAVATAV MQDSGRVWRI ERVKLDRLRE       240
     SSPAAMAAIE TGVARDMRAK LAYQNTGPDT AAQPADGPAD                             280
//

If you have problems or comments...

PBIL Back to PBIL home page