(data stored in ACNUC7421 zone)

EMBL: CP000031.PE49

CP000031.PE49        Location/Qualifiers
FT   CDS             49417..50400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0049"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93380"
FT                   /db_xref="GOA:Q5LWK8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK8"
FT                   /protein_id="AAV93380.1"
FT                   /translation="MDRGHEMSRYARQMILPQAGGEGQARLAGARVLVVGAGGLAASAL
FT                   PLLAGAGVGQIDIFDGDHIELSNLHRQTLFAEGDVGRAKAEVAAERCGALNSGIVLTGT
FT                   KRSITPENVILACRDTDLVLDCADSYAASYLLSDTCQALGKPLISASVLGLGGYVGGFC
FT                   GGAPSLRAVFPDAPDSAASCATAGVLGPVVSILGSIQAQMALSALLELAPSPLGQMVQI
FT                   DALSWRNSTFRFDGAPEPATAFRFVAPSDLSADDLIVELRTEGEAPQPAHPSARRMTVS
FT                   EIEISDTNKEKRLALCCATGLRAWRSAEQLQPIWPGEIVLVAAATS"
     MDRGHEMSRY ARQMILPQAG GEGQARLAGA RVLVVGAGGL AASALPLLAG AGVGQIDIFD        60
     GDHIELSNLH RQTLFAEGDV GRAKAEVAAE RCGALNSGIV LTGTKRSITP ENVILACRDT       120
     DLVLDCADSY AASYLLSDTC QALGKPLISA SVLGLGGYVG GFCGGAPSLR AVFPDAPDSA       180
     ASCATAGVLG PVVSILGSIQ AQMALSALLE LAPSPLGQMV QIDALSWRNS TFRFDGAPEP       240
     ATAFRFVAPS DLSADDLIVE LRTEGEAPQP AHPSARRMTV SEIEISDTNK EKRLALCCAT       300
     GLRAWRSAEQ LQPIWPGEIV LVAAATS                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page