(data stored in ACNUC7421 zone)

EMBL: CP000031.PE495

CP000031.PE495       Location/Qualifiers
FT   CDS             501090..501713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0504"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG027;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93821"
FT                   /db_xref="GOA:Q5LW39"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW39"
FT                   /protein_id="AAV93821.2"
FT                   /translation="MRFPFSMLASLVVLSSCGPSPAEREAEIASFRAGPTEAQRSDYRK
FT                   YGIIAADPDSRIYQGLAVSVSRSSSLPVSYFDVELRPISTTSGTTNPSNRIPDEILADI
FT                   PVELVRAAKAQIETGAGTGQILKLAKEIAKRTYCVGRQVGVYDLKGTKISDPASIARIM
FT                   AANGGNILGANIGDLNVKKERIPVVELKEWANTGTIMADVHLKC"
     MRFPFSMLAS LVVLSSCGPS PAEREAEIAS FRAGPTEAQR SDYRKYGIIA ADPDSRIYQG        60
     LAVSVSRSSS LPVSYFDVEL RPISTTSGTT NPSNRIPDEI LADIPVELVR AAKAQIETGA       120
     GTGQILKLAK EIAKRTYCVG RQVGVYDLKG TKISDPASIA RIMAANGGNI LGANIGDLNV       180
     KKERIPVVEL KEWANTGTIM ADVHLKC                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page