(data stored in ACNUC7421 zone)

EMBL: CP000031.PE496

CP000031.PE496       Location/Qualifiers
FT   CDS             501740..502174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0504a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG009;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0504a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86009"
FT                   /db_xref="UniProtKB/TrEMBL:V5V0I8"
FT                   /protein_id="AHB86009.1"
FT                   /translation="MALMGCKTTVDRETNAASETSPGSTVMYFDPFHGYQIVFFETPET
FT                   SWLWYPGNRTSLPALVRYKGSDVCFKYGSHTFNPVIGKQGGSWDCTPRFILDGLAVASG
FT                   EGDIFGLSDGTVPYRRRKCDGTDGFARINVDPGLYKQGCG"
     MALMGCKTTV DRETNAASET SPGSTVMYFD PFHGYQIVFF ETPETSWLWY PGNRTSLPAL        60
     VRYKGSDVCF KYGSHTFNPV IGKQGGSWDC TPRFILDGLA VASGEGDIFG LSDGTVPYRR       120
     RKCDGTDGFA RINVDPGLYK QGCG                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page