(data stored in ACNUC9435 zone)

EMBL: CP000031.PE50

CP000031.PE50        Location/Qualifiers
FT   CDS             50309..51349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0050"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="Assignment based partly on membership in ABC
FT                   transporter gene cluster."
FT                   /db_xref="EnsemblGenomes-Gn:SPO0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93381"
FT                   /db_xref="GOA:Q5LWK7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK7"
FT                   /protein_id="AAV93381.1"
FT                   /translation="MPPASGPGALRNSCNRFGRARSFSLRPPHHERKRDMKHLVTALAL
FT                   LAATPALAQDKMTLLLDWFINPDHGPIIVAQEKGYFAERGLEVEIVAPADPSAPPRLVA
FT                   AGQADLAVSYQPQLHLQIHEGLPLKRVGTLVATPLNCLLVLDNGPIKSPADLKGKKIGF
FT                   SVAGVEEAILTTVLGKYDVALSDVEMINVNFSLSPALMSGQVDAVIGAYRNFELNQMDI
FT                   EGEPGRCFYIEEEGVPSYDELIYVANPDRMDAGKIARFLEATEKATQFIVNNPQASWEI
FT                   FSATSPELQDELNKRAWADTLPRFALRPAGFDAGRYARFETFLKDSGMIDSVNSVSAIT
FT                   IDVTAE"
     MPPASGPGAL RNSCNRFGRA RSFSLRPPHH ERKRDMKHLV TALALLAATP ALAQDKMTLL        60
     LDWFINPDHG PIIVAQEKGY FAERGLEVEI VAPADPSAPP RLVAAGQADL AVSYQPQLHL       120
     QIHEGLPLKR VGTLVATPLN CLLVLDNGPI KSPADLKGKK IGFSVAGVEE AILTTVLGKY       180
     DVALSDVEMI NVNFSLSPAL MSGQVDAVIG AYRNFELNQM DIEGEPGRCF YIEEEGVPSY       240
     DELIYVANPD RMDAGKIARF LEATEKATQF IVNNPQASWE IFSATSPELQ DELNKRAWAD       300
     TLPRFALRPA GFDAGRYARF ETFLKDSGMI DSVNSVSAIT IDVTAE                      346
//

If you have problems or comments...

PBIL Back to PBIL home page