(data stored in ACNUC7421 zone)

EMBL: CP000031.PE500

CP000031.PE500       Location/Qualifiers
FT   CDS             505599..506672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AB2876"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93825"
FT                   /db_xref="GOA:Q5LW35"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW35"
FT                   /protein_id="AAV93825.1"
FT                   /translation="MKRILIGLAILAGLLAGLALAATLLATGKRPVPDQLAGYHETTLS
FT                   VGHRDVPVSLHIWYPAAQDGTAELVGQNALFYGQYVLRDAKPAPGAHPVVVFSHGSGGN
FT                   ANNHGWLATELARQGMIVVAPNHPGTMSRDSDPHRTPHIWERARDLHAILDSLETNPPL
FT                   GMQPDMDRVASAGFSLGGFSALSIAGVRVSKAAFIDYCDRHAGEFDCGWMQAASVDFAA
FT                   IDPAAYEADYRDPRIKATVSIDPALPQAMTGDSLTAATLPILLVSLGQGEEVPPATRVD
FT                   AMARQMPQARLVETPGAWHFSFLSECSTLGWIIIGLMGEENICSDIGMRDRGVLHEELK
FT                   AVISTFLSENLALSPSG"
     MKRILIGLAI LAGLLAGLAL AATLLATGKR PVPDQLAGYH ETTLSVGHRD VPVSLHIWYP        60
     AAQDGTAELV GQNALFYGQY VLRDAKPAPG AHPVVVFSHG SGGNANNHGW LATELARQGM       120
     IVVAPNHPGT MSRDSDPHRT PHIWERARDL HAILDSLETN PPLGMQPDMD RVASAGFSLG       180
     GFSALSIAGV RVSKAAFIDY CDRHAGEFDC GWMQAASVDF AAIDPAAYEA DYRDPRIKAT       240
     VSIDPALPQA MTGDSLTAAT LPILLVSLGQ GEEVPPATRV DAMARQMPQA RLVETPGAWH       300
     FSFLSECSTL GWIIIGLMGE ENICSDIGMR DRGVLHEELK AVISTFLSEN LALSPSG          357
//

If you have problems or comments...

PBIL Back to PBIL home page