(data stored in ACNUC7421 zone)

EMBL: CP000031.PE505

CP000031.PE505       Location/Qualifiers
FT   CDS             509484..509891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC52410.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93830"
FT                   /db_xref="GOA:Q5LW30"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW30"
FT                   /protein_id="AAV93830.1"
FT                   /translation="MRTSSPAGYSGRPLVAKLGFKPGWSVRAINPPPHYADLMAEAVDI
FT                   RFDPDARDADAAHLFLHGPEPLAEVAATEIAHLRPGGMLWLSWAKKSSPRHAGITEDLL
FT                   RAEVLPLGWVDVKVCAVDADWSGLKFLRRRG"
     MRTSSPAGYS GRPLVAKLGF KPGWSVRAIN PPPHYADLMA EAVDIRFDPD ARDADAAHLF        60
     LHGPEPLAEV AATEIAHLRP GGMLWLSWAK KSSPRHAGIT EDLLRAEVLP LGWVDVKVCA       120
     VDADWSGLKF LRRRG                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page