(data stored in ACNUC7421 zone)

EMBL: CP000031.PE51

CP000031.PE51        Location/Qualifiers
FT   CDS             51382..52026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0051"
FT                   /product="TENA/THI-4 family protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93382"
FT                   /db_xref="GOA:Q5LWK6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK6"
FT                   /protein_id="AAV93382.1"
FT                   /translation="MRAAAGQPWRDYTRHAFVEGMKDGSLARDAFVHYLRQDYVFLIHF
FT                   ARAWALAVVKGETHAEMLAAVGTVNTLVVEEMQLHVGVCEAAGISKDALFATPERPENL
FT                   AYTRFVLEAGYSGDLADLLAALAPCVMGYGEIGARLATEATSEAYKDWIDTYAGPEYQA
FT                   ACKAVGELMDQALTRRIGADFEASPRWERLCRTFRTATELEVGFWQMGLTP"
     MRAAAGQPWR DYTRHAFVEG MKDGSLARDA FVHYLRQDYV FLIHFARAWA LAVVKGETHA        60
     EMLAAVGTVN TLVVEEMQLH VGVCEAAGIS KDALFATPER PENLAYTRFV LEAGYSGDLA       120
     DLLAALAPCV MGYGEIGARL ATEATSEAYK DWIDTYAGPE YQAACKAVGE LMDQALTRRI       180
     GADFEASPRW ERLCRTFRTA TELEVGFWQM GLTP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page