(data stored in ACNUC7421 zone)

EMBL: CP000031.PE511

CP000031.PE511       Location/Qualifiers
FT   CDS             515315..516457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0519"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93836"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW24"
FT                   /protein_id="AAV93836.1"
FT                   /translation="MSDIAPKLGPIEGDSSFEIRSGANVCRSNRSGTGVENQEEVKMKK
FT                   SVFLGALTVAGMAAGVAAAGTMDDVKARGKLNCGVTTGLVGFAAPDSNGEWKGFDVALC
FT                   RAVAAAVLGDGNAVEFVPTTGKTRFTALASGEVDMLARNTTWTFSRDVDLKFEFVGVNY
FT                   YDGQGFMVPKSLGVSSAKELDGATVCIQTGTTTELNLADFFRANNISYEPVPIETNAEA
FT                   QQQYLAGACDVYTTDASGLAATRATFENPGDHVLLPEIISKEPLGPLVRHGDHEWGDVV
FT                   RWTLNALVSAEEMGITSANIDEMSAGTNNPEINRILGSEGTLGEMLGLDAEWAKRAIKV
FT                   GGNYGEVFAQNIGESTPIGLARGLNAQWTDGGLLYSPPFR"
     MSDIAPKLGP IEGDSSFEIR SGANVCRSNR SGTGVENQEE VKMKKSVFLG ALTVAGMAAG        60
     VAAAGTMDDV KARGKLNCGV TTGLVGFAAP DSNGEWKGFD VALCRAVAAA VLGDGNAVEF       120
     VPTTGKTRFT ALASGEVDML ARNTTWTFSR DVDLKFEFVG VNYYDGQGFM VPKSLGVSSA       180
     KELDGATVCI QTGTTTELNL ADFFRANNIS YEPVPIETNA EAQQQYLAGA CDVYTTDASG       240
     LAATRATFEN PGDHVLLPEI ISKEPLGPLV RHGDHEWGDV VRWTLNALVS AEEMGITSAN       300
     IDEMSAGTNN PEINRILGSE GTLGEMLGLD AEWAKRAIKV GGNYGEVFAQ NIGESTPIGL       360
     ARGLNAQWTD GGLLYSPPFR                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page