(data stored in ACNUC7421 zone)

EMBL: CP000031.PE512

CP000031.PE512       Location/Qualifiers
FT   CDS             516592..517860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0520"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:Q52664"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93837"
FT                   /db_xref="GOA:Q5LW23"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW23"
FT                   /protein_id="AAV93837.1"
FT                   /translation="MTTLTDPPKEQFRLSMLLYDTRYRSATIQVIAMIGFMLLAAWLIS
FT                   NTAQNLAALGKPIDFGFFSEPASYDINQRLLDYSSRDTHLRAAFIGLLNTLVVAVLGCI
FT                   TATVLGVIIGVLRLSNNWIVARLMTIYVEGFRNVPVLLWIVFIMAILIETLPAPRAFRG
FT                   DDATASMMLNDSVAVTNRGVYIPDALFSNSLGNVHLFGESSLRFDISLDLMLILIVLGG
FT                   SLWVSNFLRKRADRIQEQTGDRPVTWWQRLAVVVLPTGLVLVLLGFHLGYPELKGFNFQ
FT                   GGTHLRNSLIALWLALSLYTAAFIAEIVRAGILAISKGQTEAASALGLRSNKIMSLVIL
FT                   PQALRVIIPPLISNYLNLTKNSSLAIAVGYMDITGTLGGITMNQTGRELETILLLMLVY
FT                   LTISLSISAVMNWYNESVKLKER"
     MTTLTDPPKE QFRLSMLLYD TRYRSATIQV IAMIGFMLLA AWLISNTAQN LAALGKPIDF        60
     GFFSEPASYD INQRLLDYSS RDTHLRAAFI GLLNTLVVAV LGCITATVLG VIIGVLRLSN       120
     NWIVARLMTI YVEGFRNVPV LLWIVFIMAI LIETLPAPRA FRGDDATASM MLNDSVAVTN       180
     RGVYIPDALF SNSLGNVHLF GESSLRFDIS LDLMLILIVL GGSLWVSNFL RKRADRIQEQ       240
     TGDRPVTWWQ RLAVVVLPTG LVLVLLGFHL GYPELKGFNF QGGTHLRNSL IALWLALSLY       300
     TAAFIAEIVR AGILAISKGQ TEAASALGLR SNKIMSLVIL PQALRVIIPP LISNYLNLTK       360
     NSSLAIAVGY MDITGTLGGI TMNQTGRELE TILLLMLVYL TISLSISAVM NWYNESVKLK       420
     ER                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page