(data stored in ACNUC9435 zone)

EMBL: CP000031.PE513

CP000031.PE513       Location/Qualifiers
FT   CDS             517862..519175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0521"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, permease protein"
FT                   /note="identified by similarity to SP:Q52665"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93838"
FT                   /db_xref="GOA:Q5LW22"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW22"
FT                   /protein_id="AAV93838.1"
FT                   /translation="MSDIGFVRTEMLPEREPPASTVGALGWARANLFSNWFNSVLTLAS
FT                   LYAVFAILAAVLPWIFSPTWNGTSLSNCREILTAAGSVGDHGTSGACWGVIRERWIQLL
FT                   FGFYPSELYWRPILAFILLGVALAPVLFSDKMPSKMLIFSGLYPFIFPWLLWGGTIWGP
FT                   IAALLGFVLGWVIYSAVSKTMSSLIGILLGAAAALVWWLVLAGFFVGVFDSVLAIGIEA
FT                   VESRKFGGFMLSITIGVVAIACSLPLGIVLALGRQSDLLIVKYICVGFIEFIRGVPLIT
FT                   LLFVASTLLNIFMPPGTNFDIILRVLIMVTLFAAAYMAEVIRGGLAALPKGQYEGADSL
FT                   GLNYWQAQRLIIMPQALKISIPGIVSTFIGVFKDTVLVSIIGLLDPLGLSNAIRADANW
FT                   NGIVWEIYGFIALIFFVFCFGMSRYSMYLERKLHTGHR"
     MSDIGFVRTE MLPEREPPAS TVGALGWARA NLFSNWFNSV LTLASLYAVF AILAAVLPWI        60
     FSPTWNGTSL SNCREILTAA GSVGDHGTSG ACWGVIRERW IQLLFGFYPS ELYWRPILAF       120
     ILLGVALAPV LFSDKMPSKM LIFSGLYPFI FPWLLWGGTI WGPIAALLGF VLGWVIYSAV       180
     SKTMSSLIGI LLGAAAALVW WLVLAGFFVG VFDSVLAIGI EAVESRKFGG FMLSITIGVV       240
     AIACSLPLGI VLALGRQSDL LIVKYICVGF IEFIRGVPLI TLLFVASTLL NIFMPPGTNF       300
     DIILRVLIMV TLFAAAYMAE VIRGGLAALP KGQYEGADSL GLNYWQAQRL IIMPQALKIS       360
     IPGIVSTFIG VFKDTVLVSI IGLLDPLGLS NAIRADANWN GIVWEIYGFI ALIFFVFCFG       420
     MSRYSMYLER KLHTGHR                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page