(data stored in ACNUC7421 zone)

EMBL: CP000031.PE514

CP000031.PE514       Location/Qualifiers
FT   CDS             519186..519977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0522"
FT                   /product="glutamate/glutamine/aspartate/asparagine ABC
FT                   transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q52666"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93839"
FT                   /db_xref="GOA:Q5LW21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW21"
FT                   /protein_id="AAV93839.1"
FT                   /translation="MSELAIDREIDRSKMQVSDEVAIEITNMNKWYGAFHVLRDINLTV
FT                   YQGERIVIAGPSGSGKSTLIRCLNALEEHQQGKIVVDGTELSNDLKNIDKIRSEVGMVF
FT                   QHFNLFPHLTILENCTLAPIWVRKTPRKEAEETAMHFLEKVKIPEQALKYPGQLSGGQQ
FT                   QRVAIARSLCMRPRIMLFDEPTSALDPEMIKEVLDTMIELAEEGMTMLCVTHEMGFARQ
FT                   VANRVIFMDAGQIVEQNEPEEFFNNPQSERTKLFLSQILGH"
     MSELAIDREI DRSKMQVSDE VAIEITNMNK WYGAFHVLRD INLTVYQGER IVIAGPSGSG        60
     KSTLIRCLNA LEEHQQGKIV VDGTELSNDL KNIDKIRSEV GMVFQHFNLF PHLTILENCT       120
     LAPIWVRKTP RKEAEETAMH FLEKVKIPEQ ALKYPGQLSG GQQQRVAIAR SLCMRPRIML       180
     FDEPTSALDP EMIKEVLDTM IELAEEGMTM LCVTHEMGFA RQVANRVIFM DAGQIVEQNE       240
     PEEFFNNPQS ERTKLFLSQI LGH                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page