(data stored in ACNUC7421 zone)

EMBL: CP000031.PE517

CP000031.PE517       Location/Qualifiers
FT   CDS             complement(521164..521958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0525"
FT                   /product="sterol desaturase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93842"
FT                   /db_xref="GOA:Q5LW18"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW18"
FT                   /protein_id="AAV93842.1"
FT                   /translation="MENESLVRLAMFVGLFVLFAIAERLAPRRMVHPRRPRRWLTNLTI
FT                   SVLNTVTLRALAVGLPLLAVGAALDASALGWGLFNHLGWPGWVEVLLAVLILDFAIWGQ
FT                   HLITHKIPLLWRLHRVHHADTDIDVTTAIRFHPVEIALSMLLKIGLVYLLGPSALAVIL
FT                   FEILLNGTALFNHSNLRLPLALDAVLRKVLVTPDMHRVHHSVLREEHDSNYGFALSIWD
FT                   RMMGTYVAQPAKGHDEMTIGLAWQDDRPTRLGWSLLLPFRRR"
     MENESLVRLA MFVGLFVLFA IAERLAPRRM VHPRRPRRWL TNLTISVLNT VTLRALAVGL        60
     PLLAVGAALD ASALGWGLFN HLGWPGWVEV LLAVLILDFA IWGQHLITHK IPLLWRLHRV       120
     HHADTDIDVT TAIRFHPVEI ALSMLLKIGL VYLLGPSALA VILFEILLNG TALFNHSNLR       180
     LPLALDAVLR KVLVTPDMHR VHHSVLREEH DSNYGFALSI WDRMMGTYVA QPAKGHDEMT       240
     IGLAWQDDRP TRLGWSLLLP FRRR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page