(data stored in ACNUC7421 zone)

EMBL: CP000031.PE52

CP000031.PE52        Location/Qualifiers
FT   CDS             51960..52751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0052"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93383"
FT                   /db_xref="GOA:Q5LWK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWK5"
FT                   /protein_id="AAV93383.1"
FT                   /translation="MPDLSHRDRARGRFLADGVDPVTPAPAITVAGSASIDGARLFAPL
FT                   TLTLEAAQWTCLLGGSGVGKSTVLRLIAGLETGAEFSGAITASDDAPVLKRVAYMAQDD
FT                   LLLPWATVAQNVGLGARLRGEQVDRARLDDLLRRVRLTAHAAKRPAELSGGQRQRVALA
FT                   RTLMEDKPVVLLDEPFSALDARTRADMQELAAELLAGRTVLLVTHDPAEAARLGHSIQV
FT                   MTAAGLTPVAPPTAQIPRAVDDAATLECQAALLRMLREGVQ"
     MPDLSHRDRA RGRFLADGVD PVTPAPAITV AGSASIDGAR LFAPLTLTLE AAQWTCLLGG        60
     SGVGKSTVLR LIAGLETGAE FSGAITASDD APVLKRVAYM AQDDLLLPWA TVAQNVGLGA       120
     RLRGEQVDRA RLDDLLRRVR LTAHAAKRPA ELSGGQRQRV ALARTLMEDK PVVLLDEPFS       180
     ALDARTRADM QELAAELLAG RTVLLVTHDP AEAARLGHSI QVMTAAGLTP VAPPTAQIPR       240
     AVDDAATLEC QAALLRMLRE GVQ                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page