(data stored in ACNUC7421 zone)

EMBL: CP000031.PE521

CP000031.PE521       Location/Qualifiers
FT   CDS             complement(525224..525592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93846"
FT                   /db_xref="GOA:Q5LW14"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW14"
FT                   /protein_id="AAV93846.1"
FT                   /translation="MTFLTHFSAVLSLLAVVLTSAIPQGWMPMRKDDRILLVICTEEGE
FT                   ARQWVDLAPDSPAHEDESDARPSCHFGGLNQVAILAQPPLLMTLNHAQRTRWDNLDFTH
FT                   RSAGFFPLYDARGPPHLS"
     MTFLTHFSAV LSLLAVVLTS AIPQGWMPMR KDDRILLVIC TEEGEARQWV DLAPDSPAHE        60
     DESDARPSCH FGGLNQVAIL AQPPLLMTLN HAQRTRWDNL DFTHRSAGFF PLYDARGPPH       120
     LS                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page