(data stored in ACNUC9435 zone)

EMBL: CP000031.PE523

CP000031.PE523       Location/Qualifiers
FT   CDS             complement(526239..526976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0531"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93848"
FT                   /db_xref="GOA:Q5LW12"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW12"
FT                   /protein_id="AAV93848.1"
FT                   /translation="MTGTVTGLWRHPIKSHGREALDSVTLSPGQTMPGDRVWAVAHEMS
FT                   QADGSEWVHCGHFSRVSKVPELMAISATLNGDRVTLRHPRRPDLDFAPDAEANRFLDWV
FT                   KPLMPQDRAQSARIIRVPGRGMTDSDFPSVTLCNMASHRAVEQRIGHALSPLRWRGNIW
FT                   FDGLPLWEEFDWLDREVQIGEVVFAVRERTDRCAATTTNPETGKRDADTLGALDHWGHR
FT                   DFSVRAEVIRGGTIRLGDEVRPL"
     MTGTVTGLWR HPIKSHGREA LDSVTLSPGQ TMPGDRVWAV AHEMSQADGS EWVHCGHFSR        60
     VSKVPELMAI SATLNGDRVT LRHPRRPDLD FAPDAEANRF LDWVKPLMPQ DRAQSARIIR       120
     VPGRGMTDSD FPSVTLCNMA SHRAVEQRIG HALSPLRWRG NIWFDGLPLW EEFDWLDREV       180
     QIGEVVFAVR ERTDRCAATT TNPETGKRDA DTLGALDHWG HRDFSVRAEV IRGGTIRLGD       240
     EVRPL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page