(data stored in ACNUC7421 zone)

EMBL: CP000031.PE524

CP000031.PE524       Location/Qualifiers
FT   CDS             complement(526973..528802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0532"
FT                   /product="inner membrane protein YidC, putative"
FT                   /note="identified by similarity to SP:P25714"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93849"
FT                   /db_xref="GOA:Q5LW11"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW11"
FT                   /protein_id="AAV93849.1"
FT                   /translation="MDDQNKNLILATALSFLVILVWFILFPPPEQTEAPATEIATTNGT
FT                   AVQTPTAAATEGGAGEVPALDSAAPTQAEAPRVQIDTPRLKGSVSLLGGRIDELSLKDY
FT                   RVSLDEDAEIVEMLTPAGSTSAYYALYGWAPGAGLNAADVPGPLTEWSLESGDTLSVGT
FT                   PVTLSWSNGSGVTFRRTLAVDEDYMFTVTQSVENGSAAPIGAAPYGILARHGIGEDADL
FT                   PGLKNFFILHEGVVAMNDGTLSEIDYKDVRKFDIDPNEGAQAEVFQNKSDGWIGFTDHY
FT                   WMATLIPGSGTAFKSAAKYDARRKIYQAETVLPTMSVAPGESAEVTTRLFAGAKEWESI
FT                   RAYQQDGVQKFLDSIDWGWFFFLTKPIFWLLHQINGLIGNMGWSIIGLTLIIKAIVFPL
FT                   ALKSYVSMAKMKELQPQMEALKEAAGDDRQKMQQGMMELYKKEKVNPAAGCLPILLQIP
FT                   IFFSLYKVIFVTIELRQAPWFGPFRDLSMPDPTSIMNFFGWLPWAGPEAGSLTATILIG
FT                   ILPLLLGISMWLQQKLNPAPTDPTQAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITF
FT                   TQQYIIMRSHGYKPDVFGNIKSGFARRAKADKK"
     MDDQNKNLIL ATALSFLVIL VWFILFPPPE QTEAPATEIA TTNGTAVQTP TAAATEGGAG        60
     EVPALDSAAP TQAEAPRVQI DTPRLKGSVS LLGGRIDELS LKDYRVSLDE DAEIVEMLTP       120
     AGSTSAYYAL YGWAPGAGLN AADVPGPLTE WSLESGDTLS VGTPVTLSWS NGSGVTFRRT       180
     LAVDEDYMFT VTQSVENGSA APIGAAPYGI LARHGIGEDA DLPGLKNFFI LHEGVVAMND       240
     GTLSEIDYKD VRKFDIDPNE GAQAEVFQNK SDGWIGFTDH YWMATLIPGS GTAFKSAAKY       300
     DARRKIYQAE TVLPTMSVAP GESAEVTTRL FAGAKEWESI RAYQQDGVQK FLDSIDWGWF       360
     FFLTKPIFWL LHQINGLIGN MGWSIIGLTL IIKAIVFPLA LKSYVSMAKM KELQPQMEAL       420
     KEAAGDDRQK MQQGMMELYK KEKVNPAAGC LPILLQIPIF FSLYKVIFVT IELRQAPWFG       480
     PFRDLSMPDP TSIMNFFGWL PWAGPEAGSL TATILIGILP LLLGISMWLQ QKLNPAPTDP       540
     TQAMIFAWMP WVFMFMLGSF ASGLVVYWIA NNTITFTQQY IIMRSHGYKP DVFGNIKSGF       600
     ARRAKADKK                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page